Eclipse Sisterhood - Freeband Organization in Faelon | World Anvil

Eclipse Sisterhood - Freeband

Faction Assembly Rule: The Mershael Mender may be taken as an Ally [Independent] in an Eclipse Sisterhood freeband.   Sisterhood. In a freeband led by a Nemesis, the owning player may choose one melee combat per turn and in that combat, may exchange the combat sequence order between any two faction models.

LEADER

Nemesis (Leader)


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d12+1Sakhazet d8+1 Lethal**533d12Leader, Parry[2], Contain, Active Defense, Deceptive Strike, DEX d10, AGL d10, Hate [Traazorites]39

CASTER


 

Suneater (Caster)


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d6Long Knife d6**422d8CAR [Void Magic] d10, 15 Power, Spellblocker [1], Elusive [1], Hate [Traazorites]31
 

Void Magic

Void Magic is energy magic. This is the Freeblades spell list for the [blocklink:369471.


Power CostSpell NameEffectDuration
(2)FrictionTarget is -3 SPDC
(1)Imploded8 damage ranged attack. Those hit by this attack pass an END test or are -2dl DISC. Missile Spell.I
(1)Nullify ArmorTarget is -3 AV.C
(1)Null ShieldTarget gains Wraith [1], but the test to avoid the hit is taken on your CAR, not the target’s SPR.C
(3)ShroudTarget cannot trace LOS to any model or point in the encounter area with which it is not in contact.C
(2)StabilizeOne friendly die roll’s final result may be changed to 4.C
(2)Void DoorTarget friend within 6” of you is removed from the encounter area and cannot return this turn. Model gains Ambush.C
(1)VoidwalkTarget gains Float.C
(3)Void WallCreates a wall in a straight line 1-6” long, 1” wide and 2” tall. All of the wall must be within 18” of you and more than half of its length must be in your LOS. Friendly models do not block LOS for the purpose of placing the wall. Void Wall has no effect on LOS. Ranged attacks that trace LOS through a Void Wall are -1dl damage. Cannot be cast on top of models and models may not end their move on it. A Void Wall is Rough terrain. A model moving into contact with a Void Wall is placed in a random direction d6” from the spot at which it touched the wall, but retains the facing it had when it contacted the wall. Model stops at Impassable terrain, table edges, and friends or 1” from any enemy or engaged model. The model may continue any movement it had remaining. A model may only voluntarily contact a Void Wall once per turn. A Charge action may not include a model coming into contact with a Void Wall.C

HEROES

 

Shadow Dancer


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d10Sakhazet d8+1 Lethal**532d10Bladedancer, Parry [2], Deceptive Strike, AGL d10, Hate [Traazorites]30

Secret Sister


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d10Sakhazet d8+1 Lethal**532d10Dodge [1], AGL d12, Ambush, Elusive [1], Enhanced Disguise, Opportune Strike, Freerunner, Hate [Traazorites]29

Nightwhisper

A single Nightwhisper may be taken as an Ally [Independent] in any freeband whose leader is a woman.
 
A Nightwhisper may never be taken in a Traazorite freeband. She has the Hate [Traazorites] talent and any Traazorite model engaged with her has the Enraged talent.


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d6Long Knife d6d10Roondar d6+1 Shieldbreaker
8"-16"-24"
532d8Running Shot, Dodge [1], AGL d12, Scout, Darkvision, Elusive [1], Harasser, Freerunner, Leaper, Hate [Traazorites], Allied [Independent]30

Izchaki Chaser


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
9d10Barbed Javelin d6+1d10Barbed Javelin d6+1 Thrown,
4"-8"-12"
532d8Cavalry, Awareness, Dodge [2], AGL d12, Sidestep, Hunt d8, Pathfinder, Fast, Infiltrate, Hate [Traazorites]35

Manslayer


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d6Long Knife d6d10Roondar d6+1 Shieldbreaker
8"-16"-24"
522d8Sergeant [Manhunter], Dodge [1], AGL d10, Hunt d8, Camouflage d8, Marksman, Sniper[1], Far Shot [1], Scout, Hate[Traazorites]30

Battle Sister


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
6d10Sakhazet d8+2 Lethal**6ls52d10Parry [1], STR d10, Veteran [Fortress, 1], Veteran [Raven Stance [1], 1], Hate [Traazorites]28

FOLLOWERS

 

Rebel Maiden


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d6,
d6
Long Knife d6,
Whip d4 Entangle Quick Strike
**421d6Backstep, Hate[Traazorites]12

Throatseeker


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d8Long Knife d6**421d6Ambush, Freerunner, Hate [Traazorites]9

Manhunter


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d4Long Knife d6d6Bow d6
8"-16"-24"
421d6Infiltrate, Camouflage d6, Hunt d6, Hate [Traazorites]11

Untamed


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d62 x Long Knife d6**421d4Flurry, Hate [Traazorites]9


Articles under Eclipse Sisterhood - Freeband


Comments

Please Login in order to comment!
Powered by World Anvil